DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp50d and Obp50e

DIOPT Version :9

Sequence 1:NP_725388.2 Gene:Obp50d / 246436 FlyBaseID:FBgn0050074 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_610959.2 Gene:Obp50e / 36600 FlyBaseID:FBgn0033931 Length:196 Species:Drosophila melanogaster


Alignment Length:173 Identity:40/173 - (23%)
Similarity:77/173 - (44%) Gaps:29/173 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 CSQRPDVT--ALRNCCKLPNLDFSSFNSKCSQYLVNGV-----------HISPCSFECIFRAANA 73
            ||..|:..  .:..||:.|.||......||.:| |:|:           |:  |..:||:|...|
  Fly    24 CSAPPNFNNFDINTCCRTPELDMGDVPQKCHKY-VSGLKSANSKYPSYAHL--CYPDCIYRETGA 85

  Fly    74 LNGTHLVMENIEKMMKTIL--GSDEFVHVYLDGFRSC-----GNQEKVLIKAMKRRRVPITGKCG 131
            :....:.:..:::.::..:  ...|.|...:..|.||     |:.:.:.|::.|    .:...|.
  Fly    86 MVNGKIKVNRVKQYLEEHVHRRDQEIVSHIVQSFESCLSNVKGHMKSLNIESYK----VLPHGCS 146

  Fly   132 SMA-IMYGLCAHRYVYRNCPESVWSKSATCNEAREYSIRCDDM 173
            ..| |:|. |.:...:.|||:.:|.....||.|::::.:|:.:
  Fly   147 PFAGIIYS-CVNAETFLNCPQQMWKNEKPCNLAKQFAEQCNPL 188



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472878
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21066
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.