DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp50d and Obp50a

DIOPT Version :9

Sequence 1:NP_725388.2 Gene:Obp50d / 246436 FlyBaseID:FBgn0050074 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_995832.1 Gene:Obp50a / 246432 FlyBaseID:FBgn0050067 Length:200 Species:Drosophila melanogaster


Alignment Length:190 Identity:46/190 - (24%)
Similarity:85/190 - (44%) Gaps:27/190 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLHKLTWVLIFIPAFRAADPICSQRP-DVTALRNCCKLPNLDFSSFNSKC--------------S 50
            :|..|.::.:.|| ||||.  |...| .|..:..||..|..::..||.:|              |
  Fly     6 ILVALIFLGLIIP-FRAAK--CRAAPKSVQNVHVCCSAPLPNWGVFNRECHKSAIQASVSINRIS 67

  Fly    51 QYLVNGVH-ISPCSFECIFRAANALNGTHLVMENIEKMMKTILGSDEFVHVYLDGFRSCGNQEKV 114
            :..||..: :..|..:|.|.|::.|.|..|:...:..|::....::..:..|...|..|    ..
  Fly    68 KSKVNLANFLIKCRLDCDFNASSVLQGNRLIQAKVRPMLERAFSNEPTIDAYESNFAKC----ST 128

  Fly   115 LIKAMKRRRVPITGK---CGSMAIMYGLCAHRYVYRNCPESVWSK-SATCNEAREYSIRC 170
            ::::..:...|::.:   |...|:.|.|||:..:...||:.:|.: :..|.||:.|:.:|
  Fly   129 VVRSKYQELSPLSRQSDACDRHALFYSLCAYARLIFTCPDKMWQRNNRMCQEAKAYAKKC 188



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472877
Domainoid 1 1.000 45 1.000 Domainoid score I19323
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I7675
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21066
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.