DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp50b and Obp58d

DIOPT Version :9

Sequence 1:NP_725386.1 Gene:Obp50b / 246435 FlyBaseID:FBgn0050073 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_611711.1 Gene:Obp58d / 37609 FlyBaseID:FBgn0034770 Length:218 Species:Drosophila melanogaster


Alignment Length:226 Identity:50/226 - (22%)
Similarity:74/226 - (32%) Gaps:70/226 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 WLPLLVYSVSN------------DMGGL--QKCTELLNTHKLVYCCGKSFL-------------- 48
            |..|::.:||.            ..|.|  .||    ||.: ..||.:.::              
  Fly     8 WTFLILVAVSKAQDNEETTAVAISSGDLTEDKC----NTSR-AGCCSELYIGEEEDLVKCFVIHS 67

  Fly    49 DKFPFVGSNCTPFWDDYG------PCRYECLYRHWDLLDQDNKI--KKPELYLMITSLYSPLNGY 105
            .|.|..|.      .|.|      .|..||||:....:.:.:.|  |..:|....|.:..| ...
  Fly    68 PKLPVDGD------ADIGKTLRFLSCFVECLYKQKKYIGKSDTINMKMVKLDAEKTFVDRP-KEK 125

  Fly   106 DKYGAAFKAAHETC--EALGSRHADFLLLYSNQVADKMGMASSTCLPYAMLHAQCTMVYLTAN-C 167
            |.:.|.|    |.|  :|:|.    :.||.::..|..  :....|.||.::...|...|...: |
  Fly   126 DYHIAMF----EFCRKDAVGV----YNLLKASPGAKV--LLKGACRPYLLMVFMCISDYHQKHEC 180

  Fly   168 PRENWIDDPKCNSLQKLLSSCTKKLDEKTNA 198
            |...|....|..         ||.:.|...|
  Fly   181 PYFRWEGTAKAG---------TKDMCENAKA 202



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21066
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.