DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp50b and Obp58c

DIOPT Version :9

Sequence 1:NP_725386.1 Gene:Obp50b / 246435 FlyBaseID:FBgn0050073 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_611710.1 Gene:Obp58c / 37608 FlyBaseID:FBgn0034769 Length:199 Species:Drosophila melanogaster


Alignment Length:214 Identity:39/214 - (18%)
Similarity:66/214 - (30%) Gaps:48/214 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VLHLLGFLWLPLLVYSVSNDMGGLQ-KC--TELLNTHKLVYCC-----------GKSFLDKFPFV 54
            :|.....:|.          .||:: .|  ||.:|...:.|||           |.:....|...
  Fly     6 LLSFFSLIWF----------AGGIKIDCENTEAINEDHIHYCCKHPDGHNDLIEGCARETNFTLP 60

  Fly    55 GSNCTPFWD------DYGPCRYECLYRHWDLLDQDNKIKKPELYLMITSLY--SPLNGYDKYGAA 111
            ..|.....|      ..|.|..:|::...:|: :||.:....:..:.|..:  .|     :|...
  Fly    61 NQNEEALVDITADRAIRGTCFGKCVFSKLNLM-KDNNLDMDAVRSLFTERFPDDP-----EYAKE 119

  Fly   112 FKAAHETCEALGSRHADFLL---LYSNQVADKMGMASSTCLPYAMLHAQCTMVYLTANCPRENWI 173
            ...|.:.|......:....|   |:..       |:...|.|.:.:...|.:.....|||.:.|.
  Fly   120 MINAFDHCHGKSEENTSMFLSKPLFKQ-------MSKQFCDPKSSVVLACVIRQFFHNCPADRWS 177

  Fly   174 DDPKCNSLQKLLSSCTKKL 192
            ...:|.........|...|
  Fly   178 KTKECEDTLAFSKKCQDSL 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp50bNP_725386.1 None
Obp58cNP_611710.1 PBP_GOBP 47..135 CDD:299791 15/93 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21066
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.