DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp50b and LOC3290340

DIOPT Version :10

Sequence 1:NP_725386.1 Gene:Obp50b / 246435 FlyBaseID:FBgn0050073 Length:238 Species:Drosophila melanogaster
Sequence 2:XP_564945.2 Gene:LOC3290340 / 3290340 VectorBaseID:AGAMI1_001398 Length:198 Species:Anopheles gambiae


Alignment Length:94 Identity:23/94 - (24%)
Similarity:38/94 - (40%) Gaps:8/94 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 SLYSPLNGYDKYGAAFKAAHETCEALGSRHADFLLLYS-NQVADKMGMASSTCLPYAMLHAQCTM 160
            |:.|.|.....:|:....|.:||    :|.......|| ..::.....|..:.:|...::  |..
Mosquito    99 SMASTLGADPNFGSLVNGAVDTC----ARQIQNDPAYSVAPISSSPDRAGCSFIPQGFVN--CLY 157

  Fly   161 VYLTANCPRENWIDDPKCNSLQ-KLLSSC 188
            ..|..:||...|.:...|.:|: ||.|.|
Mosquito   158 TALFKSCPAATWTESSDCQALKTKLDSGC 186

Return to query results.
Submit another query.