DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp50c and Obp93a

DIOPT Version :9

Sequence 1:NP_725387.3 Gene:Obp50c / 246434 FlyBaseID:FBgn0050072 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_650945.1 Gene:Obp93a / 42506 FlyBaseID:FBgn0038859 Length:196 Species:Drosophila melanogaster


Alignment Length:102 Identity:22/102 - (21%)
Similarity:45/102 - (44%) Gaps:6/102 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 CLYECIFNKTN--TVVDGAIHPDNARLMLEKLFGNQ-DFEEAYFNGLMGCSDSVQEMISNRRSRP 127
            |:.||.| :||  .:.:|.::....:...::.:.|. :..:.....|..|:|..::.:...:..|
  Fly    79 CIAECSF-RTNGFLLSNGTVNTQALQKSYQQRYKNDPNMSQLMLKSLNSCTDYARKRVQEFQWMP 142

  Fly   128 QRKTEQCSPFSLFYGICAQRYVFNHCPSSSWSGTESC 164
            ::......|.:|.  .|....|:.:||:|.|..|..|
  Fly   143 KKGDCDFYPATLL--ACVMEKVYINCPTSKWKNTSDC 177



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21066
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.