DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp50c and Obp58b

DIOPT Version :9

Sequence 1:NP_725387.3 Gene:Obp50c / 246434 FlyBaseID:FBgn0050072 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_611709.1 Gene:Obp58b / 37607 FlyBaseID:FBgn0034768 Length:203 Species:Drosophila melanogaster


Alignment Length:148 Identity:33/148 - (22%)
Similarity:56/148 - (37%) Gaps:9/148 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CTRRQD--FNIVKDCCVYPTFRFDQFKSQCGKYMPVGAPRISPCLYECIFNKTNTVVDGAIHPDN 87
            |.:.||  .::.:.|.....||......:....:.|....:..|..:|:|:..|.:.:..:..|.
  Fly    40 CCKHQDGHDDVTESCAKQTNFRLPSPNEEAIVDVTVDQAMVGTCWAKCVFDHYNLMENNTLDMDK 104

  Fly    88 ARLMLEKLFGNQDFEEA--YFNGLMGC----SDSVQEMISNRRSRPQRKTEQCSPFSLFYGICAQ 146
            .| ...|.:...|.|.|  ..|....|    .::.::.:|....|.....:.|.|.|.....|..
  Fly   105 VR-SYYKRYHQTDPEYATEMLNAYEKCHTQSEEATEKFLSLPIVRAFSTAKFCKPTSSIIMSCVI 168

  Fly   147 RYVFNHCPSSSWSGTESC 164
            ...|::||:|.||.|..|
  Fly   169 YNFFHNCPASRWSNTTEC 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp50cNP_725387.3 None
Obp58bNP_611709.1 PBP_GOBP 52..154 CDD:299791 18/102 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21066
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.