powered by:
Protein Alignment Obp50c and Obp59a
DIOPT Version :9
Sequence 1: | NP_725387.3 |
Gene: | Obp50c / 246434 |
FlyBaseID: | FBgn0050072 |
Length: | 185 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_788429.1 |
Gene: | Obp59a / 37605 |
FlyBaseID: | FBgn0034766 |
Length: | 202 |
Species: | Drosophila melanogaster |
Alignment Length: | 72 |
Identity: | 17/72 - (23%) |
Similarity: | 34/72 - (47%) |
Gaps: | 10/72 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 66 CLYECIFNKTNTVVDGAIHPDNARL--MLEKLFGNQDFEEAYFNGLMGCSDSVQEMISNRRSRPQ 128
|:.:|.|.:.| :|||...||..:: :|.|...:::....: :|:||:......|..:
Fly 110 CVAQCFFEEMN-MVDGNGMPDRRKVSYLLTKDLRDRELRNFF-------TDTVQQCFRYLESNGR 166
Fly 129 RKTEQCS 135
.:..:||
Fly 167 GRHHKCS 173
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR21066 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.