DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp50c and Obp50d

DIOPT Version :9

Sequence 1:NP_725387.3 Gene:Obp50c / 246434 FlyBaseID:FBgn0050072 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_725388.2 Gene:Obp50d / 246436 FlyBaseID:FBgn0050074 Length:173 Species:Drosophila melanogaster


Alignment Length:174 Identity:53/174 - (30%)
Similarity:89/174 - (51%) Gaps:4/174 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARHIALLICSLLAMAGCDPIDVDCTRRQDFNIVKDCCVYPTFRFDQFKSQCGKYMPVGAPRISP 65
            |...:..::..:.|....|||   |::|.|...:::||..|...|..|.|:|.:|: |....|||
  Fly     1 MLHKLTWVLIFIPAFRAADPI---CSQRPDVTALRNCCKLPNLDFSSFNSKCSQYL-VNGVHISP 61

  Fly    66 CLYECIFNKTNTVVDGAIHPDNARLMLEKLFGNQDFEEAYFNGLMGCSDSVQEMISNRRSRPQRK 130
            |.:||||...|.:....:..:|...|::.:.|:.:|...|.:|...|.:..:.:|...:.|....
  Fly    62 CSFECIFRAANALNGTHLVMENIEKMMKTILGSDEFVHVYLDGFRSCGNQEKVLIKAMKRRRVPI 126

  Fly   131 TEQCSPFSLFYGICAQRYVFNHCPSSSWSGTESCEMARLQNMNC 174
            |.:|...::.||:||.|||:.:||.|.||.:.:|..||..::.|
  Fly   127 TGKCGSMAIMYGLCAHRYVYRNCPESVWSKSATCNEAREYSIRC 170



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I7675
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016779
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21066
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.