DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp50a and Obp58b

DIOPT Version :9

Sequence 1:NP_995832.1 Gene:Obp50a / 246432 FlyBaseID:FBgn0050067 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_611709.1 Gene:Obp58b / 37607 FlyBaseID:FBgn0034768 Length:203 Species:Drosophila melanogaster


Alignment Length:202 Identity:50/202 - (24%)
Similarity:78/202 - (38%) Gaps:21/202 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRTGRILVALIFLGL--IIPFRAAKCRAAPK-SVQNVHVCCSAPLPNWGVFNRECHKSAIQASVS 62
            :|.|.::..:|.|.|  ::..| ..||...: ..:|:|.||.....:..| ...|.|.......|
  Fly     2 LRIGFVICVIISLRLNGLVAVR-VHCRHMERIHEENIHHCCKHQDGHDDV-TESCAKQTNFRLPS 64

  Fly    63 INRISKSKVNLANFLI-KCRLDCDFNASSVLQGNRLIQAKVRPMLERAFSNEP-----TIDAYES 121
            .|..:...|.:...:: .|...|.|:..::::.|.|...|||...:|....:|     .::||| 
  Fly    65 PNEEAIVDVTVDQAMVGTCWAKCVFDHYNLMENNTLDMDKVRSYYKRYHQTDPEYATEMLNAYE- 128

  Fly   122 NFAKCST---VVRSKYQELSPLSRQSDA--CDRHALFYSLCAYARLIFTCPDKMWQRNNRMCQEA 181
               ||.|   ....|:..|..:...|.|  |...:.....|........||...|. |...|.|.
  Fly   129 ---KCHTQSEEATEKFLSLPIVRAFSTAKFCKPTSSIIMSCVIYNFFHNCPASRWS-NTTECVET 189

  Fly   182 KAYAKKC 188
            .|:|:||
  Fly   190 LAFARKC 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp50aNP_995832.1 None
Obp58bNP_611709.1 PBP_GOBP 52..154 CDD:299791 24/105 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472887
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21066
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.