DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp50a and Obp47b

DIOPT Version :9

Sequence 1:NP_995832.1 Gene:Obp50a / 246432 FlyBaseID:FBgn0050067 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_610669.1 Gene:Obp47b / 36207 FlyBaseID:FBgn0033614 Length:199 Species:Drosophila melanogaster


Alignment Length:120 Identity:29/120 - (24%)
Similarity:47/120 - (39%) Gaps:12/120 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 CRLDCDFNASSVL-QGNRLIQAKVRPMLERAFSNEPT-IDAYESNFAKCS-------TVVRSKYQ 135
            |..:|...:|..: :..:|..|.:|..|...|||:.. ::.....|:||.       .::..:.|
  Fly    77 CLAECILTSSKYIDEPQKLNLANIRSDLSAKFSNDTLYVETMTMAFSKCEPQSQRRLAMIMQQQQ 141

  Fly   136 EL--SPLSRQSDACDRHALFYSLCAYARLIFTCPDKMWQRNNRMCQEAKAYAKKC 188
            ::  ....:|...|...:.....|.|......|||..| ..|..|..||||..:|
  Fly   142 QVQQQKTQQQQPRCSPFSAIVLGCTYMEYFKNCPDHRW-TPNAQCTLAKAYVTQC 195



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472886
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.