DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30062 and LYZL1

DIOPT Version :9

Sequence 1:NP_725299.2 Gene:CG30062 / 246428 FlyBaseID:FBgn0050062 Length:171 Species:Drosophila melanogaster
Sequence 2:XP_005252684.1 Gene:LYZL1 / 84569 HGNCID:30502 Length:185 Species:Homo sapiens


Alignment Length:86 Identity:37/86 - (43%)
Similarity:52/86 - (60%) Gaps:5/86 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 WLCIAEFESRFNTHVVGQANADGSRDYGLFQISDRYWCAPPNRTEYYAFNDCNVNCTHLLSDDIT 115
            |:|:|.:||.:|| .......|||.|||:|||:...||   .|.:....|.|:|.|:.|::||:|
Human    93 WICMAYYESGYNT-TAQTVLDDGSIDYGIFQINSFAWC---RRGKLKENNHCHVACSALITDDLT 153

  Fly   116 MAVQCARLIQKQ-QGWTAWSV 135
            .|:.|||.|.|: ||...||:
Human   154 DAIICARKIVKETQGMNYWSL 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30062NP_725299.2 lysozyme_like 32..150 CDD:294153 37/86 (43%)
LYZL1XP_005252684.1 LYZ1 66..172 CDD:238066 35/82 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153960
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8437
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.