DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30062 and Spaca3

DIOPT Version :9

Sequence 1:NP_725299.2 Gene:CG30062 / 246428 FlyBaseID:FBgn0050062 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_001346112.1 Gene:Spaca3 / 75622 MGIID:1922872 Length:163 Species:Mus musculus


Alignment Length:130 Identity:45/130 - (34%)
Similarity:67/130 - (51%) Gaps:20/130 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 CELAGQL--YILDVPKS-ELPLWLCIAEFESRFNTHVVGQANADGSRDYGLFQISDRYWCAP--- 90
            ||||.::  :.||..:. .|..|:|:|.:.|.|||:.|.. .||||.:.|:||||.|.||..   
Mouse    41 CELAKEMHDFGLDGYRGYNLADWVCLAYYTSGFNTNAVDH-EADGSTNNGIFQISSRRWCRTLAS 104

  Fly    91 --PNRTEYYAFNDCNVNCTHLLSDDITMAVQCA-RLIQKQQGWTAWSVYPEFCNG--TLDAIDVC 150
              ||.        |.:.||.||::|:..::.|| :::|:..|...|..:...|.|  ..|.:|.|
Mouse   105 NGPNL--------CRIYCTDLLNNDLKDSIVCAMKIVQEPLGLGYWEAWRHHCQGRDLSDWVDGC 161

  Fly   151  150
            Mouse   162  161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30062NP_725299.2 lysozyme_like 32..150 CDD:294153 44/128 (34%)
Spaca3NP_001346112.1 LYZ1 36..159 CDD:238066 43/126 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844209
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4836
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8677
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.