DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30062 and Lyzl6

DIOPT Version :9

Sequence 1:NP_725299.2 Gene:CG30062 / 246428 FlyBaseID:FBgn0050062 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_001343401.1 Gene:Lyzl6 / 69444 MGIID:1916694 Length:148 Species:Mus musculus


Alignment Length:118 Identity:48/118 - (40%)
Similarity:64/118 - (54%) Gaps:14/118 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 CELAGQLYILDVPKSE---LPLWLCIAEFESRFNTHVVGQANADGSRDYGLFQISDRYWCAPPNR 93
            |.||..||..|:...|   ||.|||:|..||.||...|.: |.|||.|||:|||:.||||   |.
Mouse    25 CSLAKILYEEDLDGFEGYSLPDWLCLAFVESNFNISKVNE-NVDGSFDYGIFQINSRYWC---ND 85

  Fly    94 TEYYAFNDCNVNCTHLLSDDITMAVQCARLIQKQQG----WTAWSVYPEFCNG 142
            .:.::.|.|:|:|..|||.::...:.||:.|....|    |..|.::   |.|
Mouse    86 YQSHSENFCHVDCQELLSPNLISTIHCAKKIVSGPGGMKNWVEWKLH---CLG 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30062NP_725299.2 lysozyme_like 32..150 CDD:294153 48/118 (41%)
Lyzl6NP_001343401.1 LYZ1 21..142 CDD:238066 48/118 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844157
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4836
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8677
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.