DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30062 and Lyzl4

DIOPT Version :9

Sequence 1:NP_725299.2 Gene:CG30062 / 246428 FlyBaseID:FBgn0050062 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_001344275.2 Gene:Lyzl4 / 69032 MGIID:1916282 Length:145 Species:Mus musculus


Alignment Length:147 Identity:53/147 - (36%)
Similarity:77/147 - (52%) Gaps:16/147 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VLPLLWFLFHGIPLLAIRLQPCELAGQLYILDVPKSE---LPLWLCIAEFESRFNTHVVGQANAD 72
            ||.|:.:|.  .|:.|..|..|.:|..||...:...|   |..|:|:|.|||:||...|.:...|
Mouse     6 VLLLISYLL--TPIGASILGRCTVAKMLYDGGLNYFEGYSLENWVCLAYFESKFNPSAVYEDPQD 68

  Fly    73 GSRDYGLFQISDRYWCAPPNRTEYYAFNDCNVNCTHLLSDDITMAVQCARLIQK-QQGWTAWSVY 136
            ||..:|||||.|..||.       :..|.|:|:||.||:.::...:|||:.|.| :.|..||.::
Mouse    69 GSTGFGLFQIRDNEWCG-------HGKNLCSVSCTALLNPNLKDTIQCAKKIVKGKHGMGAWPIW 126

  Fly   137 PEFC--NGTLDA-IDVC 150
            .:.|  :..||. :|.|
Mouse   127 SKNCQLSDVLDRWLDGC 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30062NP_725299.2 lysozyme_like 32..150 CDD:294153 45/124 (36%)
Lyzl4NP_001344275.2 LYZ_C 21..143 CDD:340383 46/128 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844145
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7013
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.790

Return to query results.
Submit another query.