DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30062 and LYZL6

DIOPT Version :9

Sequence 1:NP_725299.2 Gene:CG30062 / 246428 FlyBaseID:FBgn0050062 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_001186880.1 Gene:LYZL6 / 57151 HGNCID:29614 Length:148 Species:Homo sapiens


Alignment Length:118 Identity:46/118 - (38%)
Similarity:68/118 - (57%) Gaps:14/118 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 CELAGQLYILDVPKSE---LPLWLCIAEFESRFNTHVVGQANADGSRDYGLFQISDRYWCAPPNR 93
            |:||..|.:.|:...|   |..|||:|..||:||...:.: |||||.|||||||:..|||   |.
Human    25 CDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNISKINE-NADGSFDYGLFQINSHYWC---ND 85

  Fly    94 TEYYAFNDCNVNCTHLLSDDITMAVQCA-RLIQKQQG---WTAWSVYPEFCNG 142
            .:.|:.|.|:|:|..||:.::...:.|| |::...:|   |..|.::   |:|
Human    86 YKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGARGMNNWVEWRLH---CSG 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30062NP_725299.2 lysozyme_like 32..150 CDD:294153 46/118 (39%)
LYZL6NP_001186880.1 LYZ1 22..142 CDD:238066 46/118 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153924
Domainoid 1 1.000 88 1.000 Domainoid score I7920
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8437
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.