DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30062 and MGC89221

DIOPT Version :9

Sequence 1:NP_725299.2 Gene:CG30062 / 246428 FlyBaseID:FBgn0050062 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_001004951.1 Gene:MGC89221 / 448362 XenbaseID:XB-GENE-5851163 Length:140 Species:Xenopus tropicalis


Alignment Length:93 Identity:31/93 - (33%)
Similarity:52/93 - (55%) Gaps:8/93 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 WLCIAEFESRFNTHVVGQANADGSRDYGLFQISDRYWCAPPNRTEYYAFNDCNVNCTHLLSDDIT 115
            ::|:|...||::|.:    |...: :||:|||:..:|| ...|| ....|.|.::|..||:.:|.
 Frog    45 YVCLAYQASRYDTSL----NRSPT-EYGIFQINSYWWC-DDGRT-VGRKNLCGMSCRSLLNSNIG 102

  Fly   116 MAVQC-ARLIQKQQGWTAWSVYPEFCNG 142
            ..|:| .|:::...|..||||:..:|.|
 Frog   103 DDVRCLRRIVRDPNGLDAWSVWTRYCKG 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30062NP_725299.2 lysozyme_like 32..150 CDD:294153 31/93 (33%)
MGC89221NP_001004951.1 LYZ1 20..136 CDD:238066 31/93 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9324
Panther 1 1.100 - - O PTHR11407
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.