DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30062 and CG8492

DIOPT Version :9

Sequence 1:NP_725299.2 Gene:CG30062 / 246428 FlyBaseID:FBgn0050062 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_648151.2 Gene:CG8492 / 38866 FlyBaseID:FBgn0035813 Length:1360 Species:Drosophila melanogaster


Alignment Length:144 Identity:62/144 - (43%)
Similarity:80/144 - (55%) Gaps:12/144 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 CELAGQLYIL-DVPKSELPLWLCIAEFESRFNTHVVGQANADGSRDYGLFQISDRYWCAPPNRTE 95
            ||||.:||.. ..|..|:|.|:||||.||.|||..||:.|||||.|:|||||||.|||. .::|.
  Fly   601 CELAKELYHRHKFPMREIPTWVCIAEHESSFNTAAVGKLNADGSEDHGLFQISDIYWCT-HDQTS 664

  Fly    96 YYAFNDCNVNCTHLLSDDITMAVQCARLIQKQ------QGWTAWSVYPEFC-NGTLDAIDVCFQP 153
            ..|   |::.|..||..||:..|||.|.|.::      .|:.||:||...| |..|..:..||..
  Fly   665 GKA---CHIECDRLLDSDISDDVQCIRTIHEEHTRLSGDGFNAWTVYNGHCRNQNLAKLSDCFDG 726

  Fly   154 GNATESMTSDELAE 167
            ...:|:..:....|
  Fly   727 NEISEADKTSHYGE 740

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30062NP_725299.2 lysozyme_like 32..150 CDD:294153 58/125 (46%)
CG8492NP_648151.2 LYZ1 18..142 CDD:238066
LYZ1 185..312 CDD:238066
LYZ1 439..566 CDD:238066
LYZ1 596..723 CDD:238066 58/125 (46%)
PARM 937..>1068 CDD:293666
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458888
Domainoid 1 1.000 88 1.000 Domainoid score I7920
eggNOG 1 0.900 - - E1_2BPI7
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116778at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9324
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.