DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30062 and LysP

DIOPT Version :9

Sequence 1:NP_725299.2 Gene:CG30062 / 246428 FlyBaseID:FBgn0050062 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_476828.1 Gene:LysP / 38129 FlyBaseID:FBgn0004429 Length:141 Species:Drosophila melanogaster


Alignment Length:135 Identity:64/135 - (47%)
Similarity:95/135 - (70%) Gaps:8/135 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 IPLLAIRLQP-----CELAGQLYILDVPKSELPLWLCIAEFESRFNTHVVGQANADGSRDYGLFQ 81
            :.|.|:..|.     |.||.::..|.||:.:|..|.|||:.||.|.|.|||.||::||.|||:||
  Fly    10 LTLTAVATQARTMDRCSLAREMSKLGVPRDQLAKWTCIAQHESSFRTGVVGPANSNGSNDYGIFQ 74

  Fly    82 ISDRYWCAPPNRTEYYAFNDCNVNCTHLLSDDITMAVQCARLIQKQQGWTAWSVYPEFCNGTLDA 146
            |:::|||.|.:..  :::|:|.::|..||:||||.:|:|||.||:||||||||.: ::|:|:|.:
  Fly    75 INNKYWCKPADGR--FSYNECGLSCNALLTDDITNSVKCARKIQRQQGWTAWSTW-KYCSGSLPS 136

  Fly   147 IDVCF 151
            |:.||
  Fly   137 INSCF 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30062NP_725299.2 lysozyme_like 32..150 CDD:294153 59/117 (50%)
LysPNP_476828.1 LYZ1 20..141 CDD:197612 59/123 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468991
Domainoid 1 1.000 111 1.000 Domainoid score I12139
eggNOG 1 0.900 - - E1_2BPI7
Homologene 1 1.000 - - H80675
Inparanoid 1 1.050 130 1.000 Inparanoid score I7030
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116778at33392
OrthoFinder 1 1.000 - - FOG0004526
OrthoInspector 1 1.000 - - mtm8677
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
1110.900

Return to query results.
Submit another query.