DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30062 and LysB

DIOPT Version :9

Sequence 1:NP_725299.2 Gene:CG30062 / 246428 FlyBaseID:FBgn0050062 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_001261245.1 Gene:LysB / 38125 FlyBaseID:FBgn0004425 Length:140 Species:Drosophila melanogaster


Alignment Length:129 Identity:62/129 - (48%)
Similarity:88/129 - (68%) Gaps:3/129 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PLLAIRLQPCELAGQLYILDVPKSELPLWLCIAEFESRFNTHVVGQANADGSRDYGLFQISDRYW 87
            |.|...:..|.||.::..|.||:.:|..|.||||.||.:.|.|||..|.:||.|||:|||:|.||
  Fly    15 PALGRTMDRCSLAREMSNLGVPRDQLARWACIAEHESSYRTGVVGPENYNGSNDYGIFQINDYYW 79

  Fly    88 CAPPNRTEYYAFNDCNVNCTHLLSDDITMAVQCARLIQKQQGWTAWSVYPEFCNGTLDAIDVCF 151
            ||||:..  :::|:|.::|..||:||||.:|:||:.:..||||:|||.: .:|:|.|.:||.||
  Fly    80 CAPPSGR--FSYNECGLSCNALLTDDITHSVRCAQKVLSQQGWSAWSTW-HYCSGWLPSIDDCF 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30062NP_725299.2 lysozyme_like 32..150 CDD:294153 58/117 (50%)
LysBNP_001261245.1 Lys 19..139 CDD:278491 58/122 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468993
Domainoid 1 1.000 111 1.000 Domainoid score I12139
eggNOG 1 0.900 - - E1_2BPI7
Homologene 1 1.000 - - H80675
Inparanoid 1 1.050 130 1.000 Inparanoid score I7030
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116778at33392
OrthoFinder 1 1.000 - - FOG0004526
OrthoInspector 1 1.000 - - mtm8677
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
1110.900

Return to query results.
Submit another query.