DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30062 and CG16799

DIOPT Version :9

Sequence 1:NP_725299.2 Gene:CG30062 / 246428 FlyBaseID:FBgn0050062 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_001286641.1 Gene:CG16799 / 37340 FlyBaseID:FBgn0034538 Length:179 Species:Drosophila melanogaster


Alignment Length:134 Identity:43/134 - (32%)
Similarity:73/134 - (54%) Gaps:12/134 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VLPLLWFLFHGIPLL-AIRLQPCELAGQL---YILDVPKSELPLWLCIAEFESRFNTHVVGQANA 71
            ::|:|..|..||..: :.:.|.|||...|   |..|  |:.:..|:|:.|.||..:|..|.: ..
  Fly    24 IVPVLILLQLGIEQVESKKYQRCELTRVLVENYNFD--KTFISNWICLVEHESYLDTTKVTK-KG 85

  Fly    72 DGSRDYGLFQISDRYWCAPPNRTEYYAFNDCNVNCTHLLSDDITMAVQCARLIQKQQGWTAWSVY 136
            :.|::||||||:.:.:|:...:.     ..||:.|....:|||:..:.|||:||:::|:..|..:
  Fly    86 NESKNYGLFQINSKDYCSEGRKG-----GQCNMKCEDFSNDDISDDIACARMIQEREGFKYWKGW 145

  Fly   137 PEFC 140
            ..||
  Fly   146 DRFC 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30062NP_725299.2 lysozyme_like 32..150 CDD:294153 37/112 (33%)
CG16799NP_001286641.1 LYZ1 41..162 CDD:238066 38/117 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458912
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116778at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
65.850

Return to query results.
Submit another query.