DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30062 and Lyzl4

DIOPT Version :9

Sequence 1:NP_725299.2 Gene:CG30062 / 246428 FlyBaseID:FBgn0050062 Length:171 Species:Drosophila melanogaster
Sequence 2:XP_006244185.3 Gene:Lyzl4 / 363168 RGDID:1308401 Length:265 Species:Rattus norvegicus


Alignment Length:158 Identity:57/158 - (36%)
Similarity:84/158 - (53%) Gaps:19/158 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RSSWSKVR---VLPLLWFLFHGIPLLAIRLQPCELAGQLYILDVPKSE---LPLWLCIAEFESRF 61
            |.|..|::   ||.|:.:|.  .|:.|..|..|.:|.:||...:...|   |..|:|:|.|||:|
  Rat   115 RQSLEKMQLYLVLLLISYLL--TPIGASILGRCVVAKKLYDGGLNYFEGYSLENWVCLAYFESKF 177

  Fly    62 NTHVVGQANADGSRDYGLFQISDRYWCAPPNRTEYYAFNDCNVNCTHLLSDDITMAVQCARLIQK 126
            |...|.:.:.|||..:|||||.|..||.       :..|.|:|:||.||:.::...::||:.|.|
  Rat   178 NPSAVYENSRDGSTGFGLFQIRDNEWCD-------HGKNLCSVSCTALLNPNLKDTIECAKKIVK 235

  Fly   127 -QQGWTAWSVYPEFC--NGTLDA-IDVC 150
             :||..||.|:...|  :..||. :|.|
  Rat   236 GKQGMGAWPVWSRNCQLSDILDRWLDGC 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30062NP_725299.2 lysozyme_like 32..150 CDD:294153 46/124 (37%)
Lyzl4XP_006244185.3 LYZ_C 141..263 CDD:340383 47/128 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347509
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.