DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30062 and RGD1306474

DIOPT Version :9

Sequence 1:NP_725299.2 Gene:CG30062 / 246428 FlyBaseID:FBgn0050062 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_001102216.1 Gene:RGD1306474 / 362881 RGDID:1306474 Length:151 Species:Rattus norvegicus


Alignment Length:145 Identity:47/145 - (32%)
Similarity:74/145 - (51%) Gaps:21/145 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VRVLPLLWFLFHGIPLLAIRLQ-----PCELAGQLYILDV---PKSELPLWLCIAEFESRFNTHV 65
            ::.||.|..|  |:.||:|.:|     .|.||..|....:   ....|..|:|:|:..|.::|..
  Rat     1 MKALPTLLTL--GLLLLSITVQGKVLNRCLLARTLQRFGLGGFKGISLANWICLAKSVSGYDTKA 63

  Fly    66 VGQANADGSRDYGLFQISDRYWC----APPNRTEYYAFNDCNVNCTHLLSDDITMAVQCA-RLIQ 125
            :...:.|.|.:||:||||.||||    .|.::      |.|.|:|..||.::|..:|.|| |:::
  Rat    64 IKYNHEDRSTNYGIFQISSRYWCNDSKTPGSK------NFCRVSCKALLKNNIKASVTCAKRIVK 122

  Fly   126 KQQGWTAWSVYPEFC 140
            ..:|.|.|..:.:.|
  Rat   123 DPRGITTWEAWRKNC 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30062NP_725299.2 lysozyme_like 32..150 CDD:294153 38/117 (32%)
RGD1306474NP_001102216.1 LYZ1 22..149 CDD:197612 38/122 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347547
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I4799
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8912
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X173
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.