DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30062 and CG16756

DIOPT Version :9

Sequence 1:NP_725299.2 Gene:CG30062 / 246428 FlyBaseID:FBgn0050062 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_572222.2 Gene:CG16756 / 31460 FlyBaseID:FBgn0029765 Length:152 Species:Drosophila melanogaster


Alignment Length:148 Identity:49/148 - (33%)
Similarity:71/148 - (47%) Gaps:30/148 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SWSKVRVLPLLWFLFHGIPLL---------AIRLQPCELAGQLYILD---VPKSELPLWLCIAEF 57
            ||         ::|..|:.||         |.|...||||.:|  ||   ..:|.|..|:|:.|.
  Fly     8 SW---------YWLGLGLGLLLAIECGVVSAKRFLRCELARKL--LDQHGFERSLLSNWICLLEH 61

  Fly    58 ESRFNTHVVGQANADGSRDYGLFQISDRYWCAPPNRTEYYAFNDCNVNCTHLLSDDITMAVQCAR 122
            ||..:|..: ..||:|||:||||||:.|: |....|.     ..||..|...|.:::..:|.||:
  Fly    62 ESDLDTGRI-TTNANGSRNYGLFQINGRF-CQEGRRG-----GICNAKCEDFLDENLRESVTCAK 119

  Fly   123 LIQKQQGWTAWSVYPEFC 140
            .||...|:..|:.:..:|
  Fly   120 RIQTSDGFRHWAGWQRYC 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30062NP_725299.2 lysozyme_like 32..150 CDD:294153 41/112 (37%)
CG16756NP_572222.2 LYZ1 30..145 CDD:238066 42/117 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458910
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116778at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
65.850

Return to query results.
Submit another query.