DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30062 and Lyzl6

DIOPT Version :9

Sequence 1:NP_725299.2 Gene:CG30062 / 246428 FlyBaseID:FBgn0050062 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_001129305.2 Gene:Lyzl6 / 287751 RGDID:1306968 Length:149 Species:Rattus norvegicus


Alignment Length:118 Identity:46/118 - (38%)
Similarity:67/118 - (56%) Gaps:14/118 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 CELAGQLYILDVPKSE---LPLWLCIAEFESRFNTHVVGQANADGSRDYGLFQISDRYWCAPPNR 93
            |.||..||..|:...|   ||.|||:|..||:||...|.: ||||:.|||:|||:.||||   |.
  Rat    26 CTLARILYQEDLDGFEGYSLPHWLCLAFVESKFNISKVTE-NADGTFDYGIFQINSRYWC---ND 86

  Fly    94 TEYYAFNDCNVNCTHLLSDDITMAVQCARLIQKQQG----WTAWSVYPEFCNG 142
            .:.::.|.|.::|..||:.::..::.||::|....|    |..|.::   |.|
  Rat    87 YQSHSENFCRLDCEELLNPNLIPSIHCAKMIVSGSGGMKNWVDWRLH---CLG 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30062NP_725299.2 lysozyme_like 32..150 CDD:294153 46/118 (39%)
Lyzl6NP_001129305.2 LYZ1 22..143 CDD:238066 46/118 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347521
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8912
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X173
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.