DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30062 and Lalba

DIOPT Version :9

Sequence 1:NP_725299.2 Gene:CG30062 / 246428 FlyBaseID:FBgn0050062 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_036726.1 Gene:Lalba / 24528 RGDID:2987 Length:159 Species:Rattus norvegicus


Alignment Length:147 Identity:40/147 - (27%)
Similarity:68/147 - (46%) Gaps:6/147 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VRVLPLLWFLFHGIPLLAIRLQPCELAGQLYILDVPKS-ELPLWLCIAEFESRFNTHVVGQANAD 72
            :|.:||...........|.....||::..:..:|..:. .|..|.|:....|.:::..:.:.|  
  Rat     2 MRFVPLFLACISLPAFQATEFTKCEVSHAIEDMDGYQGISLLEWTCVLFHTSGYDSQAIVKNN-- 64

  Fly    73 GSRDYGLFQISDRYWCAPPNRTEYYAFNDCNVNCTHLLSDDITMAVQCARLIQKQQGWTAWSVYP 137
            ||.:|||||||:|.||......|  :.|.|:::|...|.|::...:.||:.|...:|...|..:.
  Rat    65 GSTEYGLFQISNRNWCKSSEFPE--SENICDISCDKFLDDELADDIVCAKKIVAIKGIDYWKAHK 127

  Fly   138 EFCNGTLDAIDVCFQPG 154
            ..|:..|:... |.:||
  Rat   128 PMCSEKLEQWR-CEKPG 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30062NP_725299.2 lysozyme_like 32..150 CDD:294153 33/118 (28%)
LalbaNP_036726.1 Lys 20..137 CDD:395016 33/120 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347557
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.810

Return to query results.
Submit another query.