DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30062 and LYZL4

DIOPT Version :9

Sequence 1:NP_725299.2 Gene:CG30062 / 246428 FlyBaseID:FBgn0050062 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_001291315.1 Gene:LYZL4 / 131375 HGNCID:28387 Length:146 Species:Homo sapiens


Alignment Length:147 Identity:46/147 - (31%)
Similarity:76/147 - (51%) Gaps:15/147 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VLPLLWFLFHGIPLLAIRLQPCELAGQLYI--LDVPKS-ELPLWLCIAEFESRFNTHVVGQANAD 72
            ||.||.:|.  :|..|..|..|.:|.:|:.  ||..:. .|..|:|:|.|||:||...:.:...:
Human     6 VLSLLGYLV--VPSGAYILGRCTVAKKLHDGGLDYFEGYSLENWVCLAYFESKFNPMAIYENTRE 68

  Fly    73 GSRDYGLFQISDRYWCAPPNRTEYYAFNDCNVNCTHLLSDDITMAVQCARLIQK-QQG---WTAW 133
            |...:||||:....||....|      |.|:::|:.||:.::...::||:.|.| ::|   |..|
Human    69 GYTGFGLFQMRGSDWCGDHGR------NRCHMSCSALLNPNLEKTIKCAKTIVKGKEGMGAWPTW 127

  Fly   134 SVYPEFCNGTLDAIDVC 150
            |.|.::.:.....:|.|
Human   128 SRYCQYSDTLARWLDGC 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30062NP_725299.2 lysozyme_like 32..150 CDD:294153 37/124 (30%)
LYZL4NP_001291315.1 LYZ_C 21..144 CDD:340383 38/128 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153912
Domainoid 1 1.000 88 1.000 Domainoid score I7920
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7013
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8437
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.