DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30062 and SPACA3

DIOPT Version :9

Sequence 1:NP_725299.2 Gene:CG30062 / 246428 FlyBaseID:FBgn0050062 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_776246.1 Gene:SPACA3 / 124912 HGNCID:16260 Length:215 Species:Homo sapiens


Alignment Length:160 Identity:51/160 - (31%)
Similarity:78/160 - (48%) Gaps:17/160 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VRSSW--SKVRVLPLLWFLFHGIPLLAIRLQ-PCELAGQL--YILDVPKS-ELPLWLCIAEFESR 60
            :|..|  :.:.:|.|:..|...:|....:|. .||||..|  :.||..:. .|..|:|:|.|.|.
Human    60 LRRRWCPAGIMLLALVCLLSCLLPSSEAKLYGRCELARVLHDFGLDGYRGYSLADWVCLAYFTSG 124

  Fly    61 FNTHVVGQANADGSRDYGLFQISDRYWCA--PPNRTEYYAFNDCNVNCTHLLSDDITMAVQCA-R 122
            ||...: ...||||.:.|:|||:.|.||:  .||     ..|.|.:.|:.||:.::...|.|| :
Human   125 FNAAAL-DYEADGSTNNGIFQINSRRWCSNLTPN-----VPNVCRMYCSDLLNPNLKDTVICAMK 183

  Fly   123 LIQKQQGWTAWSVYPEFCNG--TLDAIDVC 150
            :.|:.||...|..:...|.|  ..:.:|.|
Human   184 ITQEPQGLGYWEAWRHHCQGKDLTEWVDGC 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30062NP_725299.2 lysozyme_like 32..150 CDD:294153 43/125 (34%)
SPACA3NP_776246.1 LYZ_C 88..213 CDD:340383 44/130 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153968
Domainoid 1 1.000 88 1.000 Domainoid score I7920
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8437
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.