DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30062 and LYZL2

DIOPT Version :9

Sequence 1:NP_725299.2 Gene:CG30062 / 246428 FlyBaseID:FBgn0050062 Length:171 Species:Drosophila melanogaster
Sequence 2:XP_011517608.1 Gene:LYZL2 / 119180 HGNCID:29613 Length:181 Species:Homo sapiens


Alignment Length:57 Identity:23/57 - (40%)
Similarity:32/57 - (56%) Gaps:4/57 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 WLCIAEFESRFNTHVVGQANADGSRDYGLFQISDRYWCAPPNRTEYYAFNDCNVNCT 107
            |:|:|.:||.:|| .......|||.|||:|||:...||   .|.:....|.|:|.|:
Human    93 WICMAYYESGYNT-TAQTVLDDGSIDYGIFQINSFAWC---RRGKLKENNHCHVACS 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30062NP_725299.2 lysozyme_like 32..150 CDD:294153 23/57 (40%)
LYZL2XP_011517608.1 lysozyme_like 66..>145 CDD:294153 22/55 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153959
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8437
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.