powered by:
Protein Alignment CG30062 and LYZL2
DIOPT Version :9
Sequence 1: | NP_725299.2 |
Gene: | CG30062 / 246428 |
FlyBaseID: | FBgn0050062 |
Length: | 171 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_011517608.1 |
Gene: | LYZL2 / 119180 |
HGNCID: | 29613 |
Length: | 181 |
Species: | Homo sapiens |
Alignment Length: | 57 |
Identity: | 23/57 - (40%) |
Similarity: | 32/57 - (56%) |
Gaps: | 4/57 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 51 WLCIAEFESRFNTHVVGQANADGSRDYGLFQISDRYWCAPPNRTEYYAFNDCNVNCT 107
|:|:|.:||.:|| .......|||.|||:|||:...|| .|.:....|.|:|.|:
Human 93 WICMAYYESGYNT-TAQTVLDDGSIDYGIFQINSFAWC---RRGKLKENNHCHVACS 145
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C165153959 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1551203at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
1 |
1.000 |
- |
- |
|
mtm8437 |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR11407 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X173 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
6 | 5.950 |
|
Return to query results.
Submit another query.