DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30062 and lyz

DIOPT Version :9

Sequence 1:NP_725299.2 Gene:CG30062 / 246428 FlyBaseID:FBgn0050062 Length:171 Species:Drosophila melanogaster
Sequence 2:XP_002938553.2 Gene:lyz / 100492798 XenbaseID:XB-GENE-488433 Length:153 Species:Xenopus tropicalis


Alignment Length:167 Identity:57/167 - (34%)
Similarity:79/167 - (47%) Gaps:34/167 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLWFLFHGIPLLAIR----LQPCELAGQLYILDVP---KSELPLWLCIAEFESRFNTHVVGQANA 71
            |.|   .||.:..:.    .:.|||||.:..:.:.   ...||.|:|.|.|||.|.|........
 Frog     6 LFW---GGIFIFTVTDGKLFERCELAGIMKKMGLDGYRGYSLPNWVCTAFFESSFYTDRTNFNRG 67

  Fly    72 DGSRDYGLFQISDRYWCAPPNRTEYYAFNDCNVNCTHLLSDDITMAVQCA-RLIQKQQGWTAWSV 135
            |.|.|||:.||:.|:|| ..|:|. .:.|.||:||..|||||||.:|.|| |:::..||..||..
 Frog    68 DNSTDYGILQINSRWWC-NDNKTP-GSHNACNINCRALLSDDITQSVICAKRVVRDPQGMEAWVG 130

  Fly   136 YPEFCNGTLDAIDVCFQPGNATESMTSDELAE-VKDC 171
            :...|.|.                    :|:: :|||
 Frog   131 WRNHCKGR--------------------DLSQWIKDC 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30062NP_725299.2 lysozyme_like 32..150 CDD:294153 49/121 (40%)
lyzXP_002938553.2 LYZ_C 20..147 CDD:340383 51/148 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 99 1.000 Domainoid score I6953
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 101 1.000 Inparanoid score I4849
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9324
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.