DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30060 and ybcL

DIOPT Version :10

Sequence 1:NP_725293.1 Gene:CG30060 / 246426 FlyBaseID:FBgn0265272 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_415077.1 Gene:ybcL / 945165 ECOCYCID:G6301 Length:183 Species:Escherichia coli


Alignment Length:103 Identity:22/103 - (21%)
Similarity:30/103 - (29%) Gaps:33/103 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 PIIRFKADPEHYHTLMMVDLDVPPDNNTEWLIWMVGNIPGCDVAMGQTLVAYDNRRTIHGSNIHR 125
            |.:.:...||...:..:...|......:.|..|.|.|||                          
E. coli    53 PSLTWSGVPEGTKSFAVTVYDPDAPTGSGWWHWTVVNIP-------------------------- 91

  Fly   126 IVFLAFKQYLELDF---DETFVPEGEEKGRGTFNCHNF 160
                |...||.:|.   |.|.:|.|..:||..|....|
E. coli    92 ----ATVTYLPVDAGRRDGTKLPTGAVQGRNDFGYAGF 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30060NP_725293.1 PEBP_euk 34..177 CDD:176644 22/103 (21%)
ybcLNP_415077.1 PRK09818 1..183 CDD:182092 22/103 (21%)

Return to query results.
Submit another query.