DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30060 and DNF3

DIOPT Version :9

Sequence 1:NP_725293.1 Gene:CG30060 / 246426 FlyBaseID:FBgn0265272 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_013885.1 Gene:DNF3 / 855197 SGDID:S000004772 Length:1656 Species:Saccharomyces cerevisiae


Alignment Length:95 Identity:22/95 - (23%)
Similarity:35/95 - (36%) Gaps:20/95 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 DNRRTIHGSNIHRIVF------LAFKQ--------YLELDFDETFVPEGEEKGRGTFNCHNFARK 163
            |.|||.|..:...|..      :.:||        .::..|::.:........|.||......:.
Yeast    94 DRRRTFHSKDGRHIPIILDHNAIEYKQAATKRDGHLIDERFNKPYCDNRITSSRYTFYSFLPRQL 158

  Fly   164 YALGNPMA-ANFYLVEWL-----WRWTPTY 187
            ||..:.:| ..|::|..|     |..|.||
Yeast   159 YAQFSKLANTYFFIVAVLQMIPGWSTTGTY 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30060NP_725293.1 PEBP_euk 34..177 CDD:176644 16/78 (21%)
DNF3NP_013885.1 P-type_ATPase_APLT_Dnf-like 140..1386 CDD:319770 13/49 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0206
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.