DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30060 and MRPL35

DIOPT Version :9

Sequence 1:NP_725293.1 Gene:CG30060 / 246426 FlyBaseID:FBgn0265272 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_010608.1 Gene:MRPL35 / 851921 SGDID:S000002730 Length:367 Species:Saccharomyces cerevisiae


Alignment Length:203 Identity:42/203 - (20%)
Similarity:77/203 - (37%) Gaps:49/203 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VEKLVTELKRHHVIPRLFACKPTKVISVLYPCDID----IKPGIMVVINETLKQPIIRFKA---- 67
            :::|.|.......:|.|.   |...:::.:|....    |:||..:..|.|..:||.:.:.    
Yeast   156 MQRLETLAAIPDTLPTLV---PRAEVNIKFPFSTGVNKWIEPGEFLSSNVTSMRPIFKIQEYELV 217

  Fly    68 -DPEHYHTLMMVDLDVPPDNNTEWLIWMVGNIPGCDVAMGQTLVAYDNRRTIHGSNI-------- 123
             ..:..:|:::|:.|||..:|..:...:...:...::.....|:   :.|..|.|||        
Yeast   218 NVEKQLYTVLIVNPDVPDLSNDSFKTALCYGLVNINLTYNDNLI---DPRKFHSSNIIADYLPPV 279

  Fly   124 -------HRIVFLAFKQ----------YLELDFDETFVPEGEEKGRGTFNCHNFARKYALGNPMA 171
                   .|.|...|:|          .||:|        .:|..|..|:...|.:||.| ..:.
Yeast   280 PEKNAGKQRFVVWVFRQPLIEDKQGPNMLEID--------RKELSRDDFDIRQFTKKYNL-TAIG 335

  Fly   172 ANFYLVEW 179
            |:.:..||
Yeast   336 AHIWRSEW 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30060NP_725293.1 PEBP_euk 34..177 CDD:176644 35/176 (20%)
MRPL35NP_010608.1 PEBP_euk 178..341 CDD:176644 35/174 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1728
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.