DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30060 and DNF2

DIOPT Version :9

Sequence 1:NP_725293.1 Gene:CG30060 / 246426 FlyBaseID:FBgn0265272 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_010378.1 Gene:DNF2 / 851667 SGDID:S000002500 Length:1612 Species:Saccharomyces cerevisiae


Alignment Length:164 Identity:28/164 - (17%)
Similarity:55/164 - (33%) Gaps:64/164 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FACKPTKVISVLYPCDIDIKPGIMVVINETLKQPIIRFKADPEHYHTLMMVDLDVPPDNNTEWLI 92
            |...|..:::||   |.|:...:.:::.:..:..|:|.:.                  |.|::|.
Yeast  1272 FTSVPVILLAVL---DQDVSDTVSMLVPQLYRVGILRKEW------------------NQTKFLW 1315

  Fly    93 WMVGNIPGCDVAMGQTLVAYDNRRTIHGSNIHRIVFLAFKQYLELDFDETFVPEGEEKGRGTFNC 157
            :|:                         ..:::.|...|..||.  :.:..|.  .|.|.|    
Yeast  1316 YML-------------------------DGVYQSVICFFFPYLA--YHKNMVV--TENGLG---- 1347

  Fly   158 HNFARKYALGNPMAA------NFY--LVEWLWRW 183
              ...:|.:|..:.|      |||  :.::.|.|
Yeast  1348 --LDHRYFVGVFVTAIAVTSCNFYVFMEQYRWDW 1379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30060NP_725293.1 PEBP_euk 34..177 CDD:176644 24/150 (16%)
DNF2NP_010378.1 ATPase-Plipid 229..1456 CDD:273734 28/164 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0206
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.