DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30060 and TFS1

DIOPT Version :9

Sequence 1:NP_725293.1 Gene:CG30060 / 246426 FlyBaseID:FBgn0265272 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_013279.1 Gene:TFS1 / 850875 SGDID:S000004168 Length:219 Species:Saccharomyces cerevisiae


Alignment Length:221 Identity:39/221 - (17%)
Similarity:76/221 - (34%) Gaps:72/221 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VTELKRHHVIPRLF---ACKPTKVISVLYPCDIDI-------------KPGIMVVINETLKQPII 63
            :...|:|.::..:.   :.:|:.:::|.|.....:             ||......|:.:::.:.
Yeast    12 IDSYKKHGILEDVIHDTSFQPSGILAVEYSSSAPVAMGNTLPTEKARSKPQFQFTFNKQMQKSVP 76

  Fly    64 RFKA---DPEHYHTLMMVDLDVPPDNNTEWLIWMVGNIPGCDVAM-------------------- 105
            :..|   ..:...||:|.|.|.|...:.:|..:.  ::..||:.:                    
Yeast    77 QANAYVPQDDDLFTLVMTDPDAPSKTDHKWSEFC--HLVECDLKLLNEATHETSGATEFFASEFN 139

  Fly   106 ---GQTLVAYDNRRTIHGSNIHRIVFLAFKQYLELDFDETFVPEGEEKGRGTFNCHNFARKYALG 167
               ..||:.|.......||..||.|||.:||           |:|.:..:  |:.......:..|
Yeast   140 TKGSNTLIEYMGPAPPKGSGPHRYVFLLYKQ-----------PKGVDSSK--FSKIKDRPNWGYG 191

  Fly   168 NP---------------MAANFYLVE 178
            .|               :|:||:..|
Yeast   192 TPATGVGKWAKENNLQLVASNFFYAE 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30060NP_725293.1 PEBP_euk 34..177 CDD:176644 35/196 (18%)
TFS1NP_013279.1 PEBP_euk 36..216 CDD:176644 35/194 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345742
Domainoid 1 1.000 71 1.000 Domainoid score I2241
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I1641
Isobase 1 0.950 - 0 Normalized mean entropy S1728
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X275
TreeFam 1 0.960 - -
98.900

Return to query results.
Submit another query.