DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30060 and TFL1

DIOPT Version :9

Sequence 1:NP_725293.1 Gene:CG30060 / 246426 FlyBaseID:FBgn0265272 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_196004.1 Gene:TFL1 / 831683 AraportID:AT5G03840 Length:177 Species:Arabidopsis thaliana


Alignment Length:142 Identity:47/142 - (33%)
Similarity:68/142 - (47%) Gaps:26/142 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LYPCDIDIKPGIMVVINETLKQPIIRFKADPEHYHTLMMVDLDVPPDNN---TEWLIWMVGNIPG 100
            |:|..:..||.:.:            ...|...:.||:|:|.|||..::   .|.|.|:|.||||
plant    46 LFPSSVSSKPRVEI------------HGGDLRSFFTLVMIDPDVPGPSDPFLKEHLHWIVTNIPG 98

  Fly   101 -CDVAMGQTLVAYDNRRTIHGSNIHRIVFLAFKQ-YLELDFDETFVPEGEEKGRGTFNCHNFARK 163
             .|...|:.:|:|:..|...|  |||.||:.|:| ...:.|..  :|     .|..||...||.:
plant    99 TTDATFGKEVVSYELPRPSIG--IHRFVFVLFRQKQRRVIFPN--IP-----SRDHFNTRKFAVE 154

  Fly   164 YALGNPMAANFY 175
            |.||.|:||.|:
plant   155 YDLGLPVAAVFF 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30060NP_725293.1 PEBP_euk 34..177 CDD:176644 47/142 (33%)
TFL1NP_196004.1 PEBP 4..177 CDD:412238 47/142 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 87 1.000 Domainoid score I2734
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X275
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.980

Return to query results.
Submit another query.