DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30060 and AT5G01300

DIOPT Version :10

Sequence 1:NP_725293.1 Gene:CG30060 / 246426 FlyBaseID:FBgn0265272 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_195750.1 Gene:AT5G01300 / 830983 AraportID:AT5G01300 Length:162 Species:Arabidopsis thaliana


Alignment Length:64 Identity:18/64 - (28%)
Similarity:31/64 - (48%) Gaps:6/64 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 PEHYHTLMMV--DLDVPPDNN--TEWLIWMVGNIPGCDVAMGQTLVAYDNRRT--IHGSNIHRI 126
            ||...||.:|  |:|.|..:.  ..|.:|:|.:||.....:.:.....:::.|  ..|:|.|:|
plant    44 PEGTKTLALVVEDIDAPDPSGPLVPWTVWVVVDIPPEMKGLPEGYSGNEDQTTGIREGNNDHKI 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30060NP_725293.1 PEBP_euk 34..177 CDD:176644 18/64 (28%)
AT5G01300NP_195750.1 PEBP 6..159 CDD:441485 18/64 (28%)

Return to query results.
Submit another query.