DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30060 and TSF

DIOPT Version :9

Sequence 1:NP_725293.1 Gene:CG30060 / 246426 FlyBaseID:FBgn0265272 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_193770.1 Gene:TSF / 827785 AraportID:AT4G20370 Length:175 Species:Arabidopsis thaliana


Alignment Length:137 Identity:46/137 - (33%)
Similarity:73/137 - (53%) Gaps:20/137 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 IDIKPGIMVVINETLKQPIIRFKADP-EHYHTLMMVDLDVPPDNN---TEWLIWMVGNIPG-CDV 103
            :|::|      ::.|.:||:....|. .:::||:|||.|||..:|   .|:|.|:|.:||. ...
plant    41 LDLRP------SQVLNKPIVEIGGDDFRNFYTLVMVDPDVPSPSNPHQREYLHWLVTDIPATTGN 99

  Fly   104 AMGQTLVAYDNRRTIHGSNIHRIVFLAFKQYLELDFDETFVPEGEEKGRGTFNCHNFARKYALGN 168
            |.|..:|.|::.|.  .|.|||||.:.|:|   |.....:.|...::    ||...||..|.||.
plant   100 AFGNEVVCYESPRP--PSGIHRIVLVLFRQ---LGRQTVYAPGWRQQ----FNTREFAEIYNLGL 155

  Fly   169 PMAANFY 175
            |:||:::
plant   156 PVAASYF 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30060NP_725293.1 PEBP_euk 34..177 CDD:176644 46/137 (34%)
TSFNP_193770.1 PLN00169 1..175 CDD:177765 46/137 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 87 1.000 Domainoid score I2734
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X275
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.980

Return to query results.
Submit another query.