DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30060 and Pbp2

DIOPT Version :9

Sequence 1:NP_725293.1 Gene:CG30060 / 246426 FlyBaseID:FBgn0265272 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_083871.3 Gene:Pbp2 / 76400 MGIID:1923650 Length:187 Species:Mus musculus


Alignment Length:145 Identity:43/145 - (29%)
Similarity:61/145 - (42%) Gaps:14/145 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 VLYPCDIDIKPGIMVVINETLKQPIIRFKADPEHYHTLMMVDLDVPPDNN---TEWLIWMVGNIP 99
            ||.|..:..:||           .|.....|....:||::.|.|.|....   .||..::|.|:.
Mouse    40 VLTPTQVKHRPG-----------SISWDGLDTGKLYTLILTDPDAPSRKKPVYREWHHFLVVNMK 93

  Fly   100 GCDVAMGQTLVAYDNRRTIHGSNIHRIVFLAFKQYLELDFDETFVPEGEEKGRGTFNCHNFARKY 164
            |.|::.|..|..|.......|:.:||.|:|.::|...|..||..:.......||.|....|.:||
Mouse    94 GNDISSGNVLSDYVGSGPPKGTGLHRYVWLVYQQDKPLRCDEPILTNRSGDHRGKFKTAAFRKKY 158

  Fly   165 ALGNPMAANFYLVEW 179
            .||.|:|...|..||
Mouse   159 HLGAPVAGTCYQAEW 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30060NP_725293.1 PEBP_euk 34..177 CDD:176644 41/141 (29%)
Pbp2NP_083871.3 PEBP_euk 23..171 CDD:176644 41/141 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839411
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X275
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.910

Return to query results.
Submit another query.