DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30060 and Pebp4

DIOPT Version :9

Sequence 1:NP_725293.1 Gene:CG30060 / 246426 FlyBaseID:FBgn0265272 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_082836.2 Gene:Pebp4 / 73523 MGIID:1920773 Length:242 Species:Mus musculus


Alignment Length:136 Identity:37/136 - (27%)
Similarity:59/136 - (43%) Gaps:19/136 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 KQPIIRFKADPEHYHT--------LMMVDLDVPPDNN---TEWLIWMVGNIPGCDV----AMGQT 108
            :|.|..::|....:||        |:|||.|.|..:|   ..|..|:|.||.|.|:    ..|..
Mouse    90 RQKITAWQAPIVKFHTALDGALYLLVMVDPDAPSRSNPVMKYWRHWLVSNITGADMKSGSIRGNV 154

  Fly   109 LVAYDNRRTIHGSNIHRIVFLAFKQYLELDFDETFVPEGEEKGRGTFNCHNFARKYALGNPMAAN 173
            |..|........:.:||..|..   ||:.|.|.:...| |:...|.:|...|.::|.|.:|..:.
Mouse   155 LSDYSPPTPPPETGLHRYQFFV---YLQGDRDISLSVE-EKADLGGWNLDKFLQQYGLRDPDTST 215

  Fly   174 FYLVEW 179
            .::.::
Mouse   216 QFMTQF 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30060NP_725293.1 PEBP_euk 34..177 CDD:176644 37/132 (28%)
Pebp4NP_082836.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..50
PEBP_euk 95..219 CDD:176644 35/127 (28%)
Important for secretion. /evidence=ECO:0000250|UniProtKB:Q96S96 210..242 1/12 (8%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X275
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.