DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30060 and Pebp4

DIOPT Version :10

Sequence 1:NP_725293.1 Gene:CG30060 / 246426 FlyBaseID:FBgn0265272 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_082836.2 Gene:Pebp4 / 73523 MGIID:1920773 Length:242 Species:Mus musculus


Alignment Length:136 Identity:37/136 - (27%)
Similarity:59/136 - (43%) Gaps:19/136 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 KQPIIRFKADPEHYHT--------LMMVDLDVPPDNN---TEWLIWMVGNIPGCDV----AMGQT 108
            :|.|..::|....:||        |:|||.|.|..:|   ..|..|:|.||.|.|:    ..|..
Mouse    90 RQKITAWQAPIVKFHTALDGALYLLVMVDPDAPSRSNPVMKYWRHWLVSNITGADMKSGSIRGNV 154

  Fly   109 LVAYDNRRTIHGSNIHRIVFLAFKQYLELDFDETFVPEGEEKGRGTFNCHNFARKYALGNPMAAN 173
            |..|........:.:||..|..   ||:.|.|.:...| |:...|.:|...|.::|.|.:|..:.
Mouse   155 LSDYSPPTPPPETGLHRYQFFV---YLQGDRDISLSVE-EKADLGGWNLDKFLQQYGLRDPDTST 215

  Fly   174 FYLVEW 179
            .::.::
Mouse   216 QFMTQF 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30060NP_725293.1 PEBP_euk 34..177 CDD:176644 37/132 (28%)
Pebp4NP_082836.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..50
PEBP_euk 95..219 CDD:176644 35/127 (28%)
Important for secretion. /evidence=ECO:0000250|UniProtKB:Q96S96 210..242 1/12 (8%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.