Sequence 1: | NP_725293.1 | Gene: | CG30060 / 246426 | FlyBaseID: | FBgn0265272 | Length: | 202 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_080370.2 | Gene: | Atp8b3 / 67331 | MGIID: | 1914581 | Length: | 1335 | Species: | Mus musculus |
Alignment Length: | 196 | Identity: | 39/196 - (19%) |
---|---|---|---|
Similarity: | 62/196 - (31%) | Gaps: | 83/196 - (42%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 PILC-----PVEKLVTELKRHHVIPRLFACKPTKVISVLYPCDI------------DIKPGIMVV 53
Fly 54 INETLKQPIIRFKADPEHYHTLMMVDLDVPPDNNTEWLIWMVGNIPGCDVAMGQTLVAYDNRRTI 118
Fly 119 HGSNIHRIVFLAFKQYLELDFDETFVPEGEEKGRGTFNC-------HNF-------ARKYAL--G 167
Fly 168 N 168 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG30060 | NP_725293.1 | PEBP_euk | 34..177 | CDD:176644 | 33/163 (20%) |
Atp8b3 | NP_080370.2 | PhoLip_ATPase_N | 20..96 | CDD:292826 | |
ATPase-Plipid | 45..1131 | CDD:273734 | 39/196 (20%) | ||
Cation_ATPase | 483..580 | CDD:289987 | |||
COG4087 | <839..890 | CDD:226572 | |||
PhoLip_ATPase_C | 883..1131 | CDD:292829 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1192..1215 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1236..1280 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1314..1335 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0206 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |