DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30060 and MRPL38

DIOPT Version :9

Sequence 1:NP_725293.1 Gene:CG30060 / 246426 FlyBaseID:FBgn0265272 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_115867.2 Gene:MRPL38 / 64978 HGNCID:14033 Length:380 Species:Homo sapiens


Alignment Length:143 Identity:46/143 - (32%)
Similarity:67/143 - (46%) Gaps:10/143 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 DIKP---GIMVVINETLKQPIIRFKADPEHYHTLMMVDLD---VPPDNNTEWLIWMVGNIPGCDV 103
            |:.|   |..|...|..:.|.:.::|:.....||::..||   :.||  .|:|.|::.||||..|
Human   183 DLMPVYCGNEVTPTEAAQAPEVTYEAEEGSLWTLLLTSLDGHLLEPD--AEYLHWLLTNIPGNRV 245

  Fly   104 AMGQTLVAYDNRRTIHGSNIHRIVFLAFKQYLELDFDETFVPEG-EEKGRGTFNCHNFARKY-AL 166
            |.||....|.......||.|||:.||.|||...:||.|...|.. .:..:.||...:|.:|: ..
Human   246 AEGQVTCPYLPPFPARGSGIHRLAFLLFKQDQPIDFSEDARPSPCYQLAQRTFRTFDFYKKHQET 310

  Fly   167 GNPMAANFYLVEW 179
            ..|...:|:...|
Human   311 MTPAGLSFFQCRW 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30060NP_725293.1 PEBP_euk 34..177 CDD:176644 45/139 (32%)
MRPL38NP_115867.2 PEBP_euk 171..321 CDD:176644 45/139 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.