DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30060 and atp10a

DIOPT Version :9

Sequence 1:NP_725293.1 Gene:CG30060 / 246426 FlyBaseID:FBgn0265272 Length:202 Species:Drosophila melanogaster
Sequence 2:XP_021332876.1 Gene:atp10a / 567172 ZFINID:ZDB-GENE-101102-1 Length:1524 Species:Danio rerio


Alignment Length:149 Identity:30/149 - (20%)
Similarity:48/149 - (32%) Gaps:60/149 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 DIDIKPGIMVVINETLKQ-PIIRFKADPEHYHTLMMVDLDVPPDNNTEWLIWMVGNIPGCDVAMG 106
            ||...|.:|..:||...| ..:||     |..:|.    .:|||.              |||   
Zfish   523 DITPDPQLMDKVNECSSQMEFMRF-----HSQSLN----QIPPDL--------------CDV--- 561

  Fly   107 QTLVAYDNRRTIHGSNIHRIVFLAFKQYLELDFDETFVPEGEEKGRGTFNCHNFARKYALGNPMA 171
                                    |..::.|....|.|.....:.|      ...|::.|.:|:.
Zfish   562 ------------------------FDFFIALTICNTVVVSSPNQPR------QKVRRFELKSPVK 596

  Fly   172 ANFYLVEWLWRWTPTYLVS 190
            .   :.:::.|:||:.|.|
Zfish   597 T---IEDFIKRFTPSRLTS 612

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30060NP_725293.1 PEBP_euk 34..177 CDD:176644 25/134 (19%)
atp10aXP_021332876.1 P-type_ATPase_APLT_Dnf-like 54..1188 CDD:319770 30/149 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0206
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.