DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30060 and mrpl38

DIOPT Version :9

Sequence 1:NP_725293.1 Gene:CG30060 / 246426 FlyBaseID:FBgn0265272 Length:202 Species:Drosophila melanogaster
Sequence 2:XP_012814540.2 Gene:mrpl38 / 549900 XenbaseID:XB-GENE-5959674 Length:406 Species:Xenopus tropicalis


Alignment Length:164 Identity:48/164 - (29%)
Similarity:71/164 - (43%) Gaps:21/164 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GIMVVINETLKQPIIRFKADPEHYHTLMMVDLDVPPD-----NNTEWLIWMVGNIPGCDVAMGQT 108
            |.:|...|....|.:.|:|:.....||::.:    ||     .::|:::|:||||||..|..|:.
 Frog   216 GNLVTPAEASGPPEVTFEAEEGSLWTLLLTN----PDGHLKETDSEYVLWLVGNIPGNQVHSGEQ 276

  Fly   109 LVAYDNRRTIHGSNIHRIVFLAFKQYLELDFDETFVPE--GEEKGRGTFNCHNFARKYALG-NPM 170
            :..|.......|:..||.:||.|||...::|.:...|.  ...|.| ||...:|.|||... .|.
 Frog   277 ICHYFPPFPAKGTGYHRHIFLLFKQDRRIEFKDELRPNPCHSLKLR-TFKTLDFYRKYEESLTPA 340

  Fly   171 AANFYLVEWLWRWTPTY--------LVSEHEFEP 196
            ...|:...|....|..|        .|.|:|..|
 Frog   341 GLAFFQCAWDDSVTQVYHQLLNMREPVFEYERSP 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30060NP_725293.1 PEBP_euk 34..177 CDD:176644 41/135 (30%)
mrpl38XP_012814540.2 PEBP_euk 197..347 CDD:176644 41/135 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.