DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30060 and Atp8b1

DIOPT Version :9

Sequence 1:NP_725293.1 Gene:CG30060 / 246426 FlyBaseID:FBgn0265272 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_001001488.2 Gene:Atp8b1 / 54670 MGIID:1859665 Length:1251 Species:Mus musculus


Alignment Length:68 Identity:13/68 - (19%)
Similarity:23/68 - (33%) Gaps:23/68 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VIPRLFACKPTKVISVLYPCDIDIKPGIMVVINETLKQPIIRFKADPEHYHTLMMVDLDVPPDNN 87
            :..||....|||.         :.:..:.:..:|||:              ||.:...::.....
Mouse   625 IYERLHRMNPTKQ---------ETQDALDIFASETLR--------------TLCLCYKEIEEKEF 666

  Fly    88 TEW 90
            |||
Mouse   667 TEW 669

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30060NP_725293.1 PEBP_euk 34..177 CDD:176644 9/57 (16%)
Atp8b1NP_001001488.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52
PhoLip_ATPase_N 86..142 CDD:292826
ATPase-Plipid 92..1179 CDD:273734 13/68 (19%)
E1-E2_ATPase 171..>234 CDD:278548
Cation_ATPase 534..628 CDD:289987 0/2 (0%)
HAD_like <875..919 CDD:304363
PhoLip_ATPase_C 919..1173 CDD:292829
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0206
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.