powered by:
Protein Alignment CG30060 and Atp8b1
DIOPT Version :9
Sequence 1: | NP_725293.1 |
Gene: | CG30060 / 246426 |
FlyBaseID: | FBgn0265272 |
Length: | 202 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001001488.2 |
Gene: | Atp8b1 / 54670 |
MGIID: | 1859665 |
Length: | 1251 |
Species: | Mus musculus |
Alignment Length: | 68 |
Identity: | 13/68 - (19%) |
Similarity: | 23/68 - (33%) |
Gaps: | 23/68 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 VIPRLFACKPTKVISVLYPCDIDIKPGIMVVINETLKQPIIRFKADPEHYHTLMMVDLDVPPDNN 87
:..||....|||. :.:..:.:..:|||: ||.:...::.....
Mouse 625 IYERLHRMNPTKQ---------ETQDALDIFASETLR--------------TLCLCYKEIEEKEF 666
Fly 88 TEW 90
|||
Mouse 667 TEW 669
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0206 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.