Sequence 1: | NP_725293.1 | Gene: | CG30060 / 246426 | FlyBaseID: | FBgn0265272 | Length: | 202 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_057613.4 | Gene: | ATP8A2 / 51761 | HGNCID: | 13533 | Length: | 1188 | Species: | Homo sapiens |
Alignment Length: | 122 | Identity: | 25/122 - (20%) |
---|---|---|---|
Similarity: | 42/122 - (34%) | Gaps: | 29/122 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 42 CDIDIKPGIMVVINETLKQPIIRFKADP--EHYHTLMMVDLDVPPDNNTEWLIWMVGNIPGCDVA 104
Fly 105 MGQTLVAYDNRRTIHGSNIHRIVFLAFKQYLELDFDETFVPEGEEKGRGTFNCHNFA 161 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG30060 | NP_725293.1 | PEBP_euk | 34..177 | CDD:176644 | 25/122 (20%) |
ATP8A2 | NP_057613.4 | ATPase-Plipid | 68..1106 | CDD:273734 | 25/122 (20%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1162..1188 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0206 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |