DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30060 and ATP8A2

DIOPT Version :9

Sequence 1:NP_725293.1 Gene:CG30060 / 246426 FlyBaseID:FBgn0265272 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_057613.4 Gene:ATP8A2 / 51761 HGNCID:13533 Length:1188 Species:Homo sapiens


Alignment Length:122 Identity:25/122 - (20%)
Similarity:42/122 - (34%) Gaps:29/122 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 CDIDIKPGIMVVINETLKQPIIRFKADP--EHYHTLMMVDLDVPPDNNTEWLIWMVGNIPGCDVA 104
            ||.| .|.::..|.:       |....|  :.:.||:.|...|.|:.:.:.:|:...: |     
Human   476 CDFD-DPRLLKNIED-------RHPTAPCIQEFLTLLAVCHTVVPEKDGDNIIYQASS-P----- 526

  Fly   105 MGQTLVAYDNRRTIHGSNIHRIVFLAFKQYLELDFDETFVPEGEEKGRGTFNCHNFA 161
                    |....:.|:.....||.|     ...|.......|:|:..|..|...|:
Human   527 --------DEAALVKGAKKLGFVFTA-----RTPFSVIIEAMGQEQTFGILNVLEFS 570

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30060NP_725293.1 PEBP_euk 34..177 CDD:176644 25/122 (20%)
ATP8A2NP_057613.4 ATPase-Plipid 68..1106 CDD:273734 25/122 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1162..1188
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0206
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.