DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30060 and Pebp1

DIOPT Version :9

Sequence 1:NP_725293.1 Gene:CG30060 / 246426 FlyBaseID:FBgn0265272 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_651051.1 Gene:Pebp1 / 42644 FlyBaseID:FBgn0038973 Length:176 Species:Drosophila melanogaster


Alignment Length:160 Identity:51/160 - (31%)
Similarity:83/160 - (51%) Gaps:4/160 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VIPRLFACKPTKVISVLYPCDIDIKPGIMVVINETLKQPIIRFKADPEHYHTLMMVDLDVPPDNN 87
            :||.:...||....::.||..:.::.|..:...:...||.:.|.|:|...:|:::||.|.|...:
  Fly     6 IIPDIIDVKPASKATITYPSGVQVELGKELTPTQVKDQPTVVFDAEPNSLYTILLVDPDAPSRED 70

  Fly    88 ---TEWLIWMVGNIPGCDVAMGQTLVAYDNRRTIHGSNIHRIVFLAFKQYLELDFDETFVPEGEE 149
               .|.|.|:|.||||..|:.|||:..|.......|:.:||.|||.|||..::. .|.||.:...
  Fly    71 PKFRELLHWLVINIPGNKVSEGQTIAEYIGAGPREGTGLHRYVFLVFKQNDKIT-TEKFVSKTSR 134

  Fly   150 KGRGTFNCHNFARKYALGNPMAANFYLVEW 179
            .||......::.:||:.|.|:|.||:..::
  Fly   135 TGRINVKARDYIQKYSFGGPVAGNFFQAQY 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30060NP_725293.1 PEBP_euk 34..177 CDD:176644 47/145 (32%)
Pebp1NP_651051.1 PEBP_euk 20..162 CDD:176644 47/142 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466600
Domainoid 1 1.000 87 1.000 Domainoid score I2734
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I473
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D117065at6960
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X275
88.000

Return to query results.
Submit another query.