DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30060 and pebp1

DIOPT Version :9

Sequence 1:NP_725293.1 Gene:CG30060 / 246426 FlyBaseID:FBgn0265272 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_998488.1 Gene:pebp1 / 406627 ZFINID:ZDB-GENE-040426-2621 Length:187 Species:Danio rerio


Alignment Length:154 Identity:45/154 - (29%)
Similarity:73/154 - (47%) Gaps:7/154 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PTKVISVLY-PCDIDIKPGIMVVINETLKQPI-IRFK-ADPEHYHTLMMVDLDVPPDNN---TEW 90
            |.|.::|.| ..:|| ..|.:....:...:|. |.:: .||...:||.|.|.|.|...:   .||
Zfish    21 PAKPLTVKYDSVEID-SLGKVCTPTQVQNRPTSIEWEGCDPSKLYTLAMTDPDAPSRKDPKFREW 84

  Fly    91 LIWMVGNIPGCDVAMGQTLVAYDNRRTIHGSNIHRIVFLAFKQYLELDFDETFVPEGEEKGRGTF 155
            ..::|.|:.|.||:.|..:..|.......|:.:||.|:|.::|...:...|..:.......||.|
Zfish    85 HHFLVVNVKGNDVSSGCVMSDYVGAGPPKGTGLHRYVWLVYEQSGNISCTERVLTNRSGDNRGKF 149

  Fly   156 NCHNFARKYALGNPMAANFYLVEW 179
            ...:|.:||:||.|:|.:.:..||
Zfish   150 KIQSFRKKYSLGAPLAGSCFQAEW 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30060NP_725293.1 PEBP_euk 34..177 CDD:176644 42/148 (28%)
pebp1NP_998488.1 PEBP_euk 23..171 CDD:176644 42/148 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X275
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.980

Return to query results.
Submit another query.