DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30060 and mRpL38

DIOPT Version :10

Sequence 1:NP_725293.1 Gene:CG30060 / 246426 FlyBaseID:FBgn0265272 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_511152.2 Gene:mRpL38 / 32375 FlyBaseID:FBgn0030552 Length:416 Species:Drosophila melanogaster


Alignment Length:189 Identity:50/189 - (26%)
Similarity:76/189 - (40%) Gaps:25/189 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KLVTELKRHHVIPRLFACK---PTKVISVLYPCDID----IKPGIMVVINETLKQPIIRFK--AD 68
            :||.:  .:.:...||...   |...:::.|..|.|    :..|.::...|..|.|.|.|.  .|
  Fly   124 RLVAD--HYGIFEHLFGSAYFVPRVPLNISYQLDGDSLAPVYNGNVIKPTEAAKAPQIDFDGLVD 186

  Fly    69 P--------EHYHTLMMVDLDVPPDNNT-EWLIWMVGNIPGCDVAMGQTLVAYDNRRTIHGSNIH 124
            |        :.|.||:..:.|....|.| |.|.|.:.|||...|:.||.|..|.......|....
  Fly   187 PITGQAAGQDTYWTLVASNPDAHYTNGTAECLHWFIANIPNGKVSEGQVLAEYLPPFPPRGVGYQ 251

  Fly   125 RIVFLAFKQYLELDFDETFVPEGEEKG---RGTFNCHNFARKYALG-NPMAANFYLVEW 179
            |:||:.:||...||.. ::.....:.|   :.||:..:|.|::... .|....||...|
  Fly   252 RMVFVLYKQQARLDLG-SYQLAAADYGNLEKRTFSTLDFYRQHQEQLTPAGLAFYQTNW 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30060NP_725293.1 PEBP_euk 34..177 CDD:176644 44/161 (27%)
mRpL38NP_511152.2 PEBP_euk 146..307 CDD:176644 44/161 (27%)

Return to query results.
Submit another query.