DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30060 and Mrpl38

DIOPT Version :9

Sequence 1:NP_725293.1 Gene:CG30060 / 246426 FlyBaseID:FBgn0265272 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_001009369.2 Gene:Mrpl38 / 303685 RGDID:1311180 Length:380 Species:Rattus norvegicus


Alignment Length:141 Identity:44/141 - (31%)
Similarity:65/141 - (46%) Gaps:7/141 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 IDIKPGIMVVINETLKQPIIRFKADPEHYHTLMMVDLD---VPPDNNTEWLIWMVGNIPGCDVAM 105
            |.:..|..|...|..:.|.:.::||.:...||:.::||   :.||  .|:|.|:|.|||...||.
  Rat   185 IPVYHGNEVTPTEASQAPEVTYEADKDSLWTLLFINLDGHLLEPD--AEYLHWLVTNIPSNRVAE 247

  Fly   106 GQTLVAYDNRRTIHGSNIHRIVFLAFKQYLELDFDETFVPEG-EEKGRGTFNCHNFARKYALG-N 168
            ||....|.......||..||..||.|||...::|.|...|.. .:..:.||:..:|.:|:... .
  Rat   248 GQESCPYLPPFPARGSGFHRFAFLLFKQDKPINFSEDTRPSPCYQLAQRTFHTLDFYKKHQEAMT 312

  Fly   169 PMAANFYLVEW 179
            |....|:...|
  Rat   313 PAGLAFFQCRW 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30060NP_725293.1 PEBP_euk 34..177 CDD:176644 43/137 (31%)
Mrpl38NP_001009369.2 PEBP_euk 171..321 CDD:176644 43/137 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.